PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0066500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 165aa    MW: 18740.9 Da    PI: 9.9292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0066500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l+  v  +++ +W++++++ g+ R++k+c++rw +yl
   Spipo4G0066500 16 KGPWTHEEDEKLKAFVLAHPSTSWRLVPQKAGLIRCGKSCRLRWMNYL 63
                     79********************************************97 PP

2Myb_DNA-binding49.21.2e-1569112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+el+++++   G++ W+ Ia+ ++ gRt++++k+ w++
   Spipo4G0066500  69 RGNFTQEEEELIIQLHSAVGNK-WSVIAAQLP-GRTDNEIKNLWNT 112
                      89********************.*********.**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9761163IPR017930Myb domain
SuperFamilySSF466896.36E-2913110IPR009057Homeodomain-like
SMARTSM007171.9E-101565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-231770IPR009057Homeodomain-like
CDDcd001674.82E-91863No hitNo description
PROSITE profilePS5129423.77964118IPR017930Myb domain
SMARTSM007172.8E-1368116IPR001005SANT/Myb domain
PfamPF002493.1E-1469112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2671117IPR009057Homeodomain-like
CDDcd001673.63E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGRAPCCNGE HAGLKKGPWT HEEDEKLKAF VLAHPSTSWR LVPQKAGLIR CGKSCRLRWM  60
NYLRPDIRRG NFTQEEEELI IQLHSAVGNK WSVIAAQLPG RTDNEIKNLW NTKLRKILVL  120
KGINPMTHQP LCNPLLSDYV KQCLRSIEHM LISRFVGPPP LTGGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141165106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886861.14e-62PREDICTED: protein ODORANT1-like
SwissprotQ9FLR12e-60MYB29_ARATH; Transcription factor MYB29
SwissprotQ9SZP11e-60MYB4_ARATH; Transcription repressor MYB4
TrEMBLV4MIP33e-61V4MIP3_EUTSA; Uncharacterized protein
STRINGGRMZM2G166337_P013e-60(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-62MYB-like 102